PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s922211g002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family GRF
Protein Properties Length: 320aa    MW: 34672.7 Da    PI: 9.4246
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s922211g002genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.92e-24227271145
                WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                        d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  PDK_30s922211g002 227 DPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKHVEG 271
                        79****************************************985 PP

2QLQ57.73.4e-20157193137
                QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                        ++FT++Q+++L++Q+l+yKy+ an+P+Pp Ll  i++
  PDK_30s922211g002 157 GPFTPSQWMELEHQALIYKYIDANVPIPPSLLISIRR 193
                        59******************************99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009519.3E-12157193IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.9E-15158191IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.368158193IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.455227271IPR014977WRC domain
PfamPF088799.2E-21228270IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MDIGGVVGME GLVSGASSEF GGPFSSPRVS SDSELKQRGV FCSSGRSGGF EENEWRFSKM  60
ARTEAMLAPS ITRGAAFLHR SNSHSLFPER EQMLSFSSSP SSKPDAIVLA SDETLPYYHH  120
PSSSSSTPSY LRNAGVSGWD SGGSNVNMNG VLSRMRGPFT PSQWMELEHQ ALIYKYIDAN  180
VPIPPSLLIS IRRSLNPSGF SPISSGSFGF SPLGWGSFHM GYSGNVDPEP GRCRRTDGKK  240
WRCSRDAVAD QKYCERHMNR GRHRSRKHVE GHTGYAAKAM PIIPPSQSAS AVSGSRSCSS  300
LTITQQQSNA TDPCPAPLNR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0637592e-35BT063759.1 Zea mays full-length cDNA clone ZM_BFc0104G18 mRNA, complete cds.
GenBankBT0645382e-35BT064538.1 Zea mays full-length cDNA clone ZM_BFc0179B15 mRNA, complete cds.
GenBankBT0670852e-35BT067085.1 Zea mays full-length cDNA clone ZM_BFb0185D09 mRNA, complete cds.
GenBankBT0880162e-35BT088016.1 Zea mays full-length cDNA clone ZM_BFb0357C16 mRNA, complete cds.
GenBankEU9699092e-35EU969909.1 Zea mays clone 337118 growth-regulating factor 1 mRNA, complete cds.
GenBankEU9736472e-35EU973647.1 Zea mays clone 403513 growth-regulating factor 1 mRNA, complete cds.
GenBankKJ7268772e-35KJ726877.1 Zea mays clone pUT3418 GRF transcription factor (GRF1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008785737.10.0PREDICTED: growth-regulating factor 6-like
SwissprotQ6AWY38e-65GRF6_ORYSJ; Growth-regulating factor 6
TrEMBLM0TTV61e-114M0TTV6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P26530_0011e-113(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42903568
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.17e-45growth-regulating factor 2